PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_386795528.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 555aa    MW: 61479.9 Da    PI: 8.6294
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_386795528.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161763148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT +Ede l +av+ + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Traes_3AL_386795528.1 17 KGGWTSQEDETLRKAVETFNGRSWKKIAEFFP-DRTEVQCLHRWQKVL 63
                           688*****************************.************986 PP

2Myb_DNA-binding63.73.5e-2069115148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEd++++d+vk++G+  W+ Iar ++ gR +kqc++rw+++l
  Traes_3AL_386795528.1  69 KGPWTQEEDDKIIDLVKKYGPTKWSVIARSLP-GRIGKQCRERWHNHL 115
                            79******************************.*************97 PP

3Myb_DNA-binding60.63.3e-19121164146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +++WT+eE++ l++a++++G++ W+ Ia+ ++ gRt++++k++w++
  Traes_3AL_386795528.1 121 KDAWTAEEEQALINAHREYGNK-WAEIAKVLP-GRTDNSIKNHWNS 164
                            679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8341263IPR017930Myb domain
SMARTSM007177.6E-141665IPR001005SANT/Myb domain
PfamPF002491.0E-141763IPR001005SANT/Myb domain
SuperFamilySSF466892.8E-151873IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-211975IPR009057Homeodomain-like
CDDcd001672.11E-122063No hitNo description
PROSITE profilePS5129431.78364119IPR017930Myb domain
SuperFamilySSF466891.36E-3266162IPR009057Homeodomain-like
SMARTSM007178.5E-1968117IPR001005SANT/Myb domain
PfamPF002491.6E-1869115IPR001005SANT/Myb domain
CDDcd001679.50E-1771115No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2776122IPR009057Homeodomain-like
PROSITE profilePS5129424.45120170IPR017930Myb domain
SMARTSM007171.3E-18120168IPR001005SANT/Myb domain
PfamPF002491.7E-17121164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-25123170IPR009057Homeodomain-like
CDDcd001673.34E-15123166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
QKLTYIRRTS GPIRRAKGGW TSQEDETLRK AVETFNGRSW KKIAEFFPDR TEVQCLHRWQ  60
KVLNPELIKG PWTQEEDDKI IDLVKKYGPT KWSVIARSLP GRIGKQCRER WHNHLNPDIR  120
KDAWTAEEEQ ALINAHREYG NKWAEIAKVL PGRTDNSIKN HWNSSLRKKL DVYGTRNILA  180
IPRLVGHDDF KDKQKSLASE GHLDLNTVPG ITSKNLPEIA HHSNFSSHLQ SYKLDHAKDR  240
SGFLSISFLP TVQPLTSYEV SSVVNGSAVT SAAQGLESDS VRDKGLEIIS VHEKGLKVDS  300
TLDTLGEPDS TQLDAVPAKG EESSLKNDAQ SSLGPLCYQI PNMNDVAPAS SSLISEHQTV  360
HQTSEHCRNG ALSPNGCTTP TKGTMSVQLS VDSILKIAAD SFPVTPSILR RRKRERPTPA  420
SDLKFSEPNT DSFYTPAGKH PATDTPESFR TASFLSLGSL DGLSSSARGF DVSPPYRIRA  480
KRMCLTKSVE KQLDFSSNGL GTCGSEVLNS PQQNSQSTHS LGEASIMKEK ELNGHVTQLE  540
TSTKNITYTT NMDVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C4e-73161705159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-73161705159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2364940.0HQ236494.1 Triticum aestivum MYB3R transcription factor (MYB3R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232544.20.0PREDICTED: myb-related protein A-like
TrEMBLW5CBX30.0W5CBX3_WHEAT; Uncharacterized protein
STRINGBRADI2G54640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-107myb domain protein 3r-5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]